Propanoic acid - PDFSEARCH.IO - Document Search Engine

Propanoic acid
Results: 25

#	Item
11	Robust Summaries & Test Plan: Reclaimed Substances Category; Revised Summaries Add to Reading List Source URL: www.epa.gov Language: English - Date: 2012-07-18 15:48:12 Bases Analytical chemistry Naphthenic acid Carboxylic acid Acid dissociation constant Solubility Propanoic acid Acid Partition coefficient Chemistry Equilibrium chemistry Acids
12	Robust Summaries & Test Plan: Propanoic Acid, 3-Hydroxy-2,2-Dimethyl-, 3- Hydroxy-2,2-Dimethylpropyl Ester; Test Plan Add to Reading List Source URL: www.epa.gov Language: English - Date: 2007-01-19 14:43:38 Propionates Ester Vapor pressure Chemistry Functional groups Propanoic acid
13	Robust Summaries & Test Plan: Propanoic Acid, 3-Hydroxy-2,2-Dimethyl-, 3- Hydroxy-2,2-Dimethylpropyl Ester Add to Reading List Source URL: www.epa.gov Language: English - Date: 2007-01-19 14:56:18 Propanoic acid Propionates Ester Vapor pressure Alcohol Chemistry Functional groups Antiseptics
14	8EHQ-11-18471A TSCA 8(e) Notice Add to Reading List Source URL: www.epa.gov Language: English - Date: 2012-07-24 14:00:31 IG Farben Propanoic acid Toxic Substances Control Act FedEx Rat Florham Park New Jersey Transport Aviation BASF
15	PRODUCT PRO-FILE Feed Curb A combination of organic acids that inhibit growth of mold in livestock feeds. Registration No.: [removed]Net Weight: 20kg Ingredients: Add to Reading List Source URL: pro-ag.com Language: English - Date: 2014-04-29 14:36:23 Acids Acetic acid Otologicals Sorbic acid Benzoic acid Propanoic acid Organic acid Fodder Acids in wine Chemistry Household chemicals Propionates
16	PDF Document Add to Reading List Source URL: media.wiley.com Language: English - Date: 2007-10-05 15:43:18 Otologicals Solvents Acids Acetic acid Formic acid Hydrogen peroxide Corrosive substance Propanoic acid Organic acid Chemistry Household chemicals Carboxylic acids
17	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate C - Scientific Opinions C2 - Management of scientific committees; scientific co-operation and networks Opinion of the Scientific Committee Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:31:01 Digestive system Fodder Household chemicals Benzoic acid Ruminant Propanoic acid Silage Sodium benzoate Rumen Chemistry Sodium compounds Propionates
18	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate C - Scientific Opinions &0DQDJHPHQWRIVFLHQWLILFFRPPLWWHHVVFLHQWLILFFRRSHUDWLRQDQGQHWZRUNV VW0HHWLQJRIWKH6FLHQWLILF&RP Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:42:30 Canthaxanthin Carotenoids Sodium propionate Chicken Sodium benzoate Propanoic acid Chemistry Sodium compounds Propionates
19	Microsoft Word - Examiners Report Bch 2012_final_EN_for_trans.doc Add to Reading List Source URL: documents.epo.org Language: English - Date: 2012-11-04 10:47:29 Propanoic acid Cyanide Carboxylic acid Formic acid Nitrile Acetonitrile Catalysis Claim Chemistry Solvents Acetic acid
20	Effect of Monensin on Feed Efficiency of Feedlot Cattle A. P. Raun, C. O. Cooley, E. L. Potter, R. P. Rathmacher and L. F. Richardson Add to Reading List Source URL: www.journalofanimalscience.org Language: English Ionophores Monensin Propanoic acid Amino acid Acetic acid Cattle Nutrition Urea Chemistry Nitrogen metabolism Antibiotics

UPDATE